PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0026s0330.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family STAT
Protein Properties Length: 705aa    MW: 80129.2 Da    PI: 5.8997
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0026s0330.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT188.57.8e-592193361118
                    STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikf 87 
                             ldvvllna+ q+++k++e+ asL+y d+gl+vek++d+e+pLL+s+dG+efs++drp kll+Gras+klkisqLsskc+nrLf+ik+
  SapurV1A.0026s0330.1.p 219 LDVVLLNAMRQAIDKELEIFASLIYVDNGLPVEKTSDDEDPLLTSCDGIEFSNYDRPGKLLHGRASLKLKISQLSSKCENRLFCIKI 305
                             8************************************************************************************** PP

                    STAT  88 eipklkkypfleavskpirCisrsrntrsss 118
                             eipk++ y+flea+s+pirCisrsrn r+s 
  SapurV1A.0026s0330.1.p 306 EIPKFSGYHFLEAFSHPIRCISRSRNPRTSL 336
                             **************************99764 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.60.120.2002.6E-517142IPR013320Concanavalin A-like lectin/glucanase domain
CDDcd103383.63E-55594701No hitNo description
Gene3DG3DSA:3.30.505.101.3E-6599687IPR000980SH2 domain
SuperFamilySSF555505.33E-8602673IPR000980SH2 domain
PROSITE profilePS5000110.286605687IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 705 aa     Download sequence    Send to blast
MGSRINNNVI NIKDYILLKD FRMEIEVEKE KNLSLSFWVY LIDSDTTKFP ATIIKQVHLD  60
ITSSAPFIVL NEKMITLFPL LHENKETTNS SNSALMEIKF PLENWIHVGF EVLTDILRLH  120
INGDIVSEQP QSSSLDKNWN SNGPRKIALV GACADDGLQG YVYRAEVLPL SLSIKDHYVK  180
DPPLWLSIDL SSTSEIDEGN DGIWNIVGGK ASCRRVFSLD VVLLNAMRQA IDKELEIFAS  240
LIYVDNGLPV EKTSDDEDPL LTSCDGIEFS NYDRPGKLLH GRASLKLKIS QLSSKCENRL  300
FCIKIEIPKF SGYHFLEAFS HPIRCISRSR NPRTSLTWKR PTTVVEPFNK FQSFGLYNGS  360
IELQHNSIHE IRPSPSSKRI KLGQEKTSAM EKPNVECYSD TWTTNQVENT PRISLDMGVE  420
NVEEADNSSS VSDSIEGRLS NFKITSSSCY SISDVTIFKY CLGGLIDKAL LLKEVATSAA  480
EQELFRLANE VSLYSGCSHH RRQIVIAKRL IEEGTKIWNS ISQNNRLIQW EKVIFEIEEQ  540
FMRITCSSTR SLTEQDFELL RRIAGCREHM GQENFEKMWR WLYPVIFTLA SDPINTTWNS  600
TSPKWIEGFI TKEEAELSLQ GPRGLQEPGT FVLRFPTSRS WPHPDAGSLI VTYVGSDYTV  660
HHRLLSLDYI YSCEERGVNL KSLEQMLLAE PELSRLGRIV RQSQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2080851e-121AC208085.1 Populus trichocarpa clone JGIACSB05-D05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011009094.10.0PREDICTED: uncharacterized protein LOC105114285 isoform X1
TrEMBLU5FZW00.0U5FZW0_POPTR; Uncharacterized protein
STRINGPOPTR_0011s10360.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67103036
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.10.0SH2 domain protein B